PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100177970121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 236aa    MW: 26735.3 Da    PI: 9.1074
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100177970121genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.9e-33660155
                       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                  kprlrWt++LH+rFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  Ote100177970121|100177970121  6 KPRLRWTSDLHDRFVDAVTKLGGPDKATPKSVLRVMGLKGLTLYHLKSHLQKYRL 60
                                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-32363IPR009057Homeodomain-like
PROSITE profilePS5129411.788363IPR017930Myb domain
TIGRFAMsTIGR015574.6E-25661IPR006447Myb domain, plants
SuperFamilySSF466893.58E-16663IPR009057Homeodomain-like
PfamPF002492.9E-8859IPR001005SANT/Myb domain
PfamPF143792.7E-23103148IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MTRDPKPRLR WTSDLHDRFV DAVTKLGGPD KATPKSVLRV MGLKGLTLYH LKSHLQKYRL  60
GQQQARKQNG LDHNTDFNEN PYGRHSMNTA SSSMNTDRGR EIPIAEAVRC QIEVQKTLQE  120
QLEVQKKLQM RIEAQGKYLQ AILEKAQRSL CADANHSESL ESTKAQLTDF NLALSSFMQT  180
INGDDIKSVV KEAEVGREMK LKVEEPCVEF DLNSRSSYDF IGINGSGFEA KPLQNR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092595.11e-127PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-50APL_ARATH; Myb family transcription factor APL
TrEMBLA0A022Q6L91e-118A0A022Q6L9_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000240507e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139